PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT07941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 413aa    MW: 44642.1 Da    PI: 8.4858
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT07941genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-1590134347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++++ kqlG+g+W+ I++ + ++Rt+ q+ s+ qky
         EMT07941  90 PWTEEEHRKFLEGLKQLGKGDWRGISKNFVTTRTATQVASHAQKY 134
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.74483139IPR017930Myb domain
SuperFamilySSF466893.73E-1884139IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-1886138IPR006447Myb domain, plants
SMARTSM007172.7E-1187137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-1288133IPR009057Homeodomain-like
PfamPF002491.5E-1290134IPR001005SANT/Myb domain
CDDcd001672.63E-1090135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MEEEGARKAV LFRLFGVEVR GAEEDDDAEP MELKKSTSMP NLACASIVPI LLPGEASNDK  60
GYASDDGELA STPQLKRRRR KAQERKKGIP WTEEEHRKFL EGLKQLGKGD WRGISKNFVT  120
TRTATQVASH AQKYFLRQTN PGKKKRRASL FDVGIPAGHS YDDQLPSPQS VGTKLAPAEK  180
ILHTDRGDVP LPSYPGGIRG NSNNIQMQVE ELTDHVKKRS KFPTGTSLAA MAASGLELAM  240
SSSASSILEL SIAPPRCYGA VDAIKLVKGN QRGYVVVLAS HGDITEILAL ALEGPPWHRA  300
HELNHARSGV GFLLPSEEAA MTGEDGFFLC PCGSELPMAS IIGLCLHFAL HVHSLIGPWH  360
GNISRACYGH AISSCLLAVV MLAKGSGQKQ LAKPCQTQIF PLLSDHVGCT SRA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17580KRRRRK
27586KRRRRKAQERKK
37686RRRRKAQERKK
4142146KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519340.0JF951934.1 Aegilops speltoides clone TaMYB51 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572080.11e-109PREDICTED: protein REVEILLE 1
TrEMBLM8B1R10.0M8B1R1_AEGTA; Myb-like protein J
STRINGMLOC_10280.21e-152(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104643043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.15e-31MYB_related family protein